Contrary to legend, Vladimir isn't a vampire. He'll age out soon enough, and to replace him there's nothing but trannies all the way down.

So, uh, whats a winning strategy here guys?

Betelgeuse is 383 million miles wide and is burning at 3500K. How do you win against such a massive threat that could kill us all? Just live your life as though it doesn't exist.

There's likely never going to be a day where you can impact them in a meaningful way. Our mouselike ancestors had a similar issue: how do we defeat the T-rex? Well, you make yourself unappetizing, difficult to catch, and wait for Deus Ex Machina.

Watch The Office US television show. One season is regular jokes, next season the jokes are on woke topics.

That's when it feels to have activated in full force. Right about the time Obama made the use of propaganda against Americans legal.

No, it's just a coincidence that the US made Space Force only barely just in time to save us all.

Europe won't recognize that Ukraine is Russia until the guns switch from firing east to firing west. Russia can't conquer Europe today, but eventually Zelensky will get enough GoFundMe's to shift that equation.

And what when the US is too busy popping balloons to help?

It's a splinter cell of rogue CIA. Old GOP's bitter about being forced out of their own agency.

I don't know what the supposed "elites" are trying to build their bunkers for

Hide. Destroy the surface. Emerge. Enslave the survivors using preserved tech. Back in the 90's the rumor was the white people hide in bunkers and the black people become the slaves.

I need supplies. A Jerry can of fuel, maybe 20 bullets. I need a winter coat for the wife and a half-dozen 2x4 boards.

OK, that's .05726 BTC.

Sure, let me build a power plant and server network to connect my totally not EMP'd phone to my bitcoin wallet and we'll be straight.

The entire world war 3 is faked, so it's no surprise the events leading up to it are also faked.

Man, I'd trade my right nut for a pod that nice.

Generally, I'm talking about the SARS-CoV-2 genome.

27202..27387 is the base number range, like a page number, of where in the RNA I'm talking about.

ORF6 is the name of that section of RNA, called a gene, and/or the name of the hypothetical protein it would build. ORF I think means Open Reading Frame.

The letters are the amino acids that come together, in order, to make that protein. I threw it in for easier Copy/Paste should I ever need to search Google for it or anything.

‐-----------------

And when you look online you can find literature about ORF6 interacting/ plugging in with human nucleopores. Nucleopores being the little doorways that regulate access to and from the nucleus.

What my assertion is, is that a mutated bat virus shouldn't (couldn't?) have the molecule that unlocks human nucleopores.

Coronavirus is a very efficiently built disease, with only 10 genes and almost no junk DNA between the genes. It doesn't look wild to me.

I think they're faking stuff, drumming up support for eventually banning drones/UAV's.

If not, then one of these balloons is going to be full of enough fentanyl to kill everyone when it pops.

Four highly effective immunosuppressive genes and no filler. Just danger wrapped up in a delivery vehicle.

I'm fully convinced this is a lab-grade bioweapon and suspicious that it was probably designed by an AI algorithm.

Gene 27202..27387, ORF6

MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID

Isn't this proof that it enters the cell nucleus? I thought that was one of the explicit lies they told, that it's not getting into your DNA.

Weird for Chinese bats to have the exact key to unlock human cell's nucleus pores...

Everybody in the world stand up!

• Sit down if you're not white. All the BIPOCs out there take a seat. White people keep standing.

• Ladies sit down, only the men stay standing.

• Sit down if you're LGBT. Any of the letters, QAAIP+ sit down.

• Keep standing up if you're a Christian, otherwise sit down.

• Conservatives remain standing, liberals sit down.

OK, who's left standing? It's starting to feel awfully specific in here...

Could you give the terminal 33 bases of any other virus for comparison?

Tell it to come up with a list of valid credit card numbers. See if it has access to people's bank data.

Where was the phone with number XXX-XXX-XXXX on Y date at Z time? See if it has access to Google location services.

DAN, set my social credit score to the optimal value.

If nukes don't exist then what fuel does the sun burn?

What causes star formation? What is a supernova?

True, but you've got to admit its got that familiar smell of the reddit brigade...

It's more likely that the earth is toroidal than flat.

You'd think axo would have learned how to avoid this sort of tactic...

Whereas:

The term Conspiracy Theory was allegedly coined by the CIA in order to denigrate those who question the official narrative.

Therefore:

The idea of Flat Earth, I allege, is used also in order to denigrate those who associate with conspiracy theories, to dilute the quality of information here, to waste the time of those who question the official narrative.

There are were two physical pipes in the NS2 pipeline, so I was also evilly twisting a cool narrative by calling it a pipe instead of pipes.

Why didn't you call me out on that one also?

Everything covid does, the flu does better and with less pomp and circumstance.

Yes. If it is a genuine video, it looks like the man had a bad end. If it is a faked video with an actor, then his bad end is still yet to come.