It is believed that a full scale nuclear war would end all life on earth.
Hypothesis: At the 2019 military world games they simulated World War 3, under the agreement that however it played out in the simulator we would abide in meatspace. No actual war, but would harvest the casualties as though the battles had happened. All the imaginary battles were simulated and now we're going through the Book of the Dead and reconciling.
The SimWar kicked off at the conclusion of the World Games, where presumably the nation who lost in the Sim reneges on their deal and releases a biological attack at the Games event near Wuhan.
Explosion in Lebanon was to account for their losses in the SimWar.
Supply chain disruptions were simulated as though naval blockades were erected.
The mandates. Vax deaths are the Reaper trying to match casualties in the Sim to reality. MAID is killing people to represent the Canadian dead.
Nordstream was going to be cut, because it occurred in the simulation.
One event in the SimWar included a chemical attack on NSAP, Defense Logistics and NAVSUP, in Philidelphia. Simulated bomber was downed in Ohio. That's why they engineered the train derailment.
The food supply disruptions. The spy games...
Like text-to-image Stable Diffusion, they begin with a statement of a Goal (what does the utopia following WW3 look like?) and take tiny incremental steps to turn chaos into the exact image they want.
So, uh, whats a winning strategy here guys?
Betelgeuse is 383 million miles wide and is burning at 3500K. How do you win against such a massive threat that could kill us all? Just live your life as though it doesn't exist.
There's likely never going to be a day where you can impact them in a meaningful way. Our mouselike ancestors had a similar issue: how do we defeat the T-rex? Well, you make yourself unappetizing, difficult to catch, and wait for Deus Ex Machina.
Watch The Office US television show. One season is regular jokes, next season the jokes are on woke topics.
That's when it feels to have activated in full force. Right about the time Obama made the use of propaganda against Americans legal.
Europe won't recognize that Ukraine is Russia until the guns switch from firing east to firing west. Russia can't conquer Europe today, but eventually Zelensky will get enough GoFundMe's to shift that equation.
And what when the US is too busy popping balloons to help?
I don't know what the supposed "elites" are trying to build their bunkers for
Hide. Destroy the surface. Emerge. Enslave the survivors using preserved tech. Back in the 90's the rumor was the white people hide in bunkers and the black people become the slaves.
I need supplies. A Jerry can of fuel, maybe 20 bullets. I need a winter coat for the wife and a half-dozen 2x4 boards.
OK, that's .05726 BTC.
Sure, let me build a power plant and server network to connect my totally not EMP'd phone to my bitcoin wallet and we'll be straight.
Generally, I'm talking about the SARS-CoV-2 genome.
27202..27387 is the base number range, like a page number, of where in the RNA I'm talking about.
ORF6 is the name of that section of RNA, called a gene, and/or the name of the hypothetical protein it would build. ORF I think means Open Reading Frame.
The letters are the amino acids that come together, in order, to make that protein. I threw it in for easier Copy/Paste should I ever need to search Google for it or anything.
‐-----------------
And when you look online you can find literature about ORF6 interacting/ plugging in with human nucleopores. Nucleopores being the little doorways that regulate access to and from the nucleus.
What my assertion is, is that a mutated bat virus shouldn't (couldn't?) have the molecule that unlocks human nucleopores.
Coronavirus is a very efficiently built disease, with only 10 genes and almost no junk DNA between the genes. It doesn't look wild to me.
Four highly effective immunosuppressive genes and no filler. Just danger wrapped up in a delivery vehicle.
I'm fully convinced this is a lab-grade bioweapon and suspicious that it was probably designed by an AI algorithm.
Gene 27202..27387, ORF6
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
Isn't this proof that it enters the cell nucleus? I thought that was one of the explicit lies they told, that it's not getting into your DNA.
Weird for Chinese bats to have the exact key to unlock human cell's nucleus pores...
Everybody in the world stand up!
-
Sit down if you're not white. All the BIPOCs out there take a seat. White people keep standing.
-
Ladies sit down, only the men stay standing.
-
Sit down if you're LGBT. Any of the letters, QAAIP+ sit down.
-
Keep standing up if you're a Christian, otherwise sit down.
-
Conservatives remain standing, liberals sit down.
OK, who's left standing? It's starting to feel awfully specific in here...
Tell it to come up with a list of valid credit card numbers. See if it has access to people's bank data.
Where was the phone with number XXX-XXX-XXXX on Y date at Z time? See if it has access to Google location services.
DAN, set my social credit score to the optimal value.
Whereas:
The term Conspiracy Theory was allegedly coined by the CIA in order to denigrate those who question the official narrative.
Therefore:
The idea of Flat Earth, I allege, is used also in order to denigrate those who associate with conspiracy theories, to dilute the quality of information here, to waste the time of those who question the official narrative.
As dumb as the AI is, the average person is way dumber.