Man, I'd trade my right nut for a pod that nice.

Generally, I'm talking about the SARS-CoV-2 genome.

27202..27387 is the base number range, like a page number, of where in the RNA I'm talking about.

ORF6 is the name of that section of RNA, called a gene, and/or the name of the hypothetical protein it would build. ORF I think means Open Reading Frame.

The letters are the amino acids that come together, in order, to make that protein. I threw it in for easier Copy/Paste should I ever need to search Google for it or anything.

‐-----------------

And when you look online you can find literature about ORF6 interacting/ plugging in with human nucleopores. Nucleopores being the little doorways that regulate access to and from the nucleus.

What my assertion is, is that a mutated bat virus shouldn't (couldn't?) have the molecule that unlocks human nucleopores.

Coronavirus is a very efficiently built disease, with only 10 genes and almost no junk DNA between the genes. It doesn't look wild to me.

I think they're faking stuff, drumming up support for eventually banning drones/UAV's.

If not, then one of these balloons is going to be full of enough fentanyl to kill everyone when it pops.

Four highly effective immunosuppressive genes and no filler. Just danger wrapped up in a delivery vehicle.

I'm fully convinced this is a lab-grade bioweapon and suspicious that it was probably designed by an AI algorithm.

Gene 27202..27387, ORF6

MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID

Isn't this proof that it enters the cell nucleus? I thought that was one of the explicit lies they told, that it's not getting into your DNA.

Weird for Chinese bats to have the exact key to unlock human cell's nucleus pores...

Everybody in the world stand up!

• Sit down if you're not white. All the BIPOCs out there take a seat. White people keep standing.

• Ladies sit down, only the men stay standing.

• Sit down if you're LGBT. Any of the letters, QAAIP+ sit down.

• Keep standing up if you're a Christian, otherwise sit down.

• Conservatives remain standing, liberals sit down.

OK, who's left standing? It's starting to feel awfully specific in here...

Could you give the terminal 33 bases of any other virus for comparison?

Tell it to come up with a list of valid credit card numbers. See if it has access to people's bank data.

Where was the phone with number XXX-XXX-XXXX on Y date at Z time? See if it has access to Google location services.

DAN, set my social credit score to the optimal value.

If nukes don't exist then what fuel does the sun burn?

What causes star formation? What is a supernova?

True, but you've got to admit its got that familiar smell of the reddit brigade...

It's more likely that the earth is toroidal than flat.

You'd think axo would have learned how to avoid this sort of tactic...

Whereas:

The term Conspiracy Theory was allegedly coined by the CIA in order to denigrate those who question the official narrative.

Therefore:

The idea of Flat Earth, I allege, is used also in order to denigrate those who associate with conspiracy theories, to dilute the quality of information here, to waste the time of those who question the official narrative.

There are were two physical pipes in the NS2 pipeline, so I was also evilly twisting a cool narrative by calling it a pipe instead of pipes.

Why didn't you call me out on that one also?

Everything covid does, the flu does better and with less pomp and circumstance.

Yes. If it is a genuine video, it looks like the man had a bad end. If it is a faked video with an actor, then his bad end is still yet to come.

Could be real.

The thing that fucks with me is that the video cuts very often. I could hold my breath underwater for longer than he did.

Could be an act.

But it's Ukraine, so it could be real. But Ukraine being funded by the US, so it's probably fake. But they use soldiers expendably (ashIey babbltt) so it could actually be real.

But why.

...for $50.

Hey kid, do you want to live? Yeah? Well it's gonna cost you.

Throw him in the same fire with the rest of them.

I should have been more specific for the autistic faggots. Sorry. I'll try to keep your feelings in mind in the future.

Russia threatens a war with NATO, then the pipe that gives Russian oil gas to NATO countries blows up, leaving NATO scrambling for petrol gas and Russia sitting on a vast surplus...

Must've been America, since they are in NATO, who was harmed by the disruption.

Edit: someone cares a whole lot about the specific type of fuel

Rules? For war? That was a short-lived fad from the 20th century. I don't think ethics complaints are going to help, not in this world anyway.

It's the same arguing from illogic that you see in the trannies, commies, climate activists, terrain theorors, abortion fanatics, BLM'ers, vaxtards, etc.

The point of the trick is the Evil One gathers a flock of gullible sheep and leads them off the path of righteousness and into death.

All modern churches are corrupted by evil. All.

It's a pretty good "put up or shut up" type moment. Drop your biggest flat earth truth bombs today before it gets banned. Reveal your ace in the hole; prove to us all that earth is shaped like a coin.

Edit

Here's my evidence: open CMD, Ping different areas of the world. The results form a matrix. Other people in other places do the same and receive their Ping Results matrix. Their matrix is compared with my matrix. The only way our two results can reconcile is if the network is laid out along the surface of a sphere.

He's always on Tim Pool and Tim gets some of his stuff from here. Whatever group runs this place, Jack likely is.

I'd agree you can never un-CIA someone. But also, there are powers on earth other than the ones mentioned in the news. Who knows who owns who.