Win / Conspiracies
Conspiracies
Communities Topics Log In Sign Up
Sign In
Hot
All Posts
Settings
All
Profile
Saved
Upvoted
Hidden
Messages

Your Communities

General
AskWin
Funny
Technology
Animals
Sports
Gaming
DIY
Health
Positive
Privacy
News
Changelogs

More Communities

frenworld
OhTwitter
MillionDollarExtreme
NoNewNormal
Ladies
Conspiracies
GreatAwakening
IP2Always
GameDev
ParallelSociety
Privacy Policy
Terms of Service
Content Policy
DEFAULT COMMUNITIES • All General AskWin Funny Technology Animals Sports Gaming DIY Health Positive Privacy
Conspiracies Conspiracy Theories & Facts
hot new rising top

Sign In or Create an Account

27
()
posted 3 years ago by ghost_of_aswartz 3 years ago by ghost_of_aswartz +27 / -0
52 comments share
52 comments share save hide report block hide replies
You're viewing a single comment thread. View all comments, or full comment thread.
Comments (52)
sorted by:
▲ 7 ▼
– deleted 7 points 3 years ago +7 / -0
▲ 7 ▼
– wereonit 7 points 3 years ago +7 / -0

THIS.

Any college genetics or molecular bio course will cover this. Also, there is not 1 genome for COVID there are millions of different genomes. Counting the As in the poly-A tail is notoriously hard. Different reads of the same sample will give different numbers.

permalink parent save report block reply
▲ 2 ▼
– IGOexiled 2 points 3 years ago +2 / -0

Gene 27202..27387, ORF6

MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID

Isn't this proof that it enters the cell nucleus? I thought that was one of the explicit lies they told, that it's not getting into your DNA.

Weird for Chinese bats to have the exact key to unlock human cell's nucleus pores...

permalink parent save report block reply
▲ 1 ▼
– deleted 1 point 3 years ago +1 / -0
▲ 1 ▼
– IGOexiled 1 point 3 years ago +1 / -0

Four highly effective immunosuppressive genes and no filler. Just danger wrapped up in a delivery vehicle.

I'm fully convinced this is a lab-grade bioweapon and suspicious that it was probably designed by an AI algorithm.

permalink parent save report block reply
▲ 1 ▼
– Occams-razor-burn 1 point 3 years ago +1 / -0

Could you elaborate on what you are talking about here and what those letters mean?

permalink parent save report block reply
▲ 2 ▼
– IGOexiled 2 points 3 years ago +2 / -0

Generally, I'm talking about the SARS-CoV-2 genome.

27202..27387 is the base number range, like a page number, of where in the RNA I'm talking about.

ORF6 is the name of that section of RNA, called a gene, and/or the name of the hypothetical protein it would build. ORF I think means Open Reading Frame.

The letters are the amino acids that come together, in order, to make that protein. I threw it in for easier Copy/Paste should I ever need to search Google for it or anything.

‐-----------------

And when you look online you can find literature about ORF6 interacting/ plugging in with human nucleopores. Nucleopores being the little doorways that regulate access to and from the nucleus.

What my assertion is, is that a mutated bat virus shouldn't (couldn't?) have the molecule that unlocks human nucleopores.

Coronavirus is a very efficiently built disease, with only 10 genes and almost no junk DNA between the genes. It doesn't look wild to me.

permalink parent save report block reply
▲ 2 ▼
– Occams-razor-burn 2 points 3 years ago +2 / -0

Thank you very much for this. I used to follow more info about people investigating the actual virus and what isn't be said about it but that got lost in the noise over vaccines debates and arguments over disinformation.

permalink parent save report block reply
▲ 1 ▼
– deleted 1 point 3 years ago +1 / -0
▲ 1 ▼
– deleted 1 point 3 years ago +1 / -0
▲ 1 ▼
– deleted 1 point 3 years ago +1 / -0
▲ 2 ▼
– deleted 2 points 3 years ago +2 / -0
▲ 2 ▼
– deleted 2 points 3 years ago +2 / -0
▲ 2 ▼
– deleted 2 points 3 years ago +2 / -0
▲ 1 ▼
– probeinserted 1 point 3 years ago +1 / -0

It does not look at all like a fuse. That the end of the genome is going to decay after a time triggering something after the replication has resulted in the tail being cut.

permalink parent save report block reply
... continue reading thread?

GIFs

Conspiracies Wiki & Links

Conspiracies Book List

External Digital Book Libraries

Mod Logs

Honor Roll

Conspiracies.win: This is a forum for free thinking and for discussing issues which have captured your imagination. Please respect other views and opinions, and keep an open mind. Our goal is to create a fairer and more transparent world for a better future.

Community Rules: <click this link for a detailed explanation of the rules

Rule 1: Be respectful. Attack the argument, not the person.

Rule 2: Don't abuse the report function.

Rule 3: No subversion.

To prevent SPAM, posts from accounts younger than 4 days old, and/or with <50 points, wont appear in the feed until approved by a mod.

Disclaimer: Submissions/comments of exceptionally low quality, trolling, stalking, spam, and those submissions/comments determined to be intentionally misleading, calls to violence and/or abuse of other users here, may all be removed at moderator's discretion.

Moderators

  • Doggos
  • axolotl_peyotl
  • trinadin
  • PutinLovesCats
  • clemaneuverers
  • C
  • Perun
  • Thisisnotanexit
Message the Moderators

Terms of Service | Privacy Policy

2026.02.01 - 8wn6p (status)

Copyright © 2026.

Terms of Service | Privacy Policy