Generally, I'm talking about the SARS-CoV-2 genome.
27202..27387 is the base number range, like a page number, of where in the RNA I'm talking about.
ORF6 is the name of that section of RNA, called a gene, and/or the name of the hypothetical protein it would build. ORF I think means Open Reading Frame.
The letters are the amino acids that come together, in order, to make that protein. I threw it in for easier Copy/Paste should I ever need to search Google for it or anything.
‐-----------------
And when you look online you can find literature about ORF6 interacting/ plugging in with human nucleopores. Nucleopores being the little doorways that regulate access to and from the nucleus.
What my assertion is, is that a mutated bat virus shouldn't (couldn't?) have the molecule that unlocks human nucleopores.
Coronavirus is a very efficiently built disease, with only 10 genes and almost no junk DNA between the genes. It doesn't look wild to me.
Thank you very much for this. I used to follow more info about people investigating the actual virus and what isn't be said about it but that got lost in the noise over vaccines debates and arguments over disinformation.
Gene 27202..27387, ORF6
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
Isn't this proof that it enters the cell nucleus? I thought that was one of the explicit lies they told, that it's not getting into your DNA.
Weird for Chinese bats to have the exact key to unlock human cell's nucleus pores...
Could you elaborate on what you are talking about here and what those letters mean?
Generally, I'm talking about the SARS-CoV-2 genome.
27202..27387 is the base number range, like a page number, of where in the RNA I'm talking about.
ORF6 is the name of that section of RNA, called a gene, and/or the name of the hypothetical protein it would build. ORF I think means Open Reading Frame.
The letters are the amino acids that come together, in order, to make that protein. I threw it in for easier Copy/Paste should I ever need to search Google for it or anything.
‐-----------------
And when you look online you can find literature about ORF6 interacting/ plugging in with human nucleopores. Nucleopores being the little doorways that regulate access to and from the nucleus.
What my assertion is, is that a mutated bat virus shouldn't (couldn't?) have the molecule that unlocks human nucleopores.
Coronavirus is a very efficiently built disease, with only 10 genes and almost no junk DNA between the genes. It doesn't look wild to me.
Thank you very much for this. I used to follow more info about people investigating the actual virus and what isn't be said about it but that got lost in the noise over vaccines debates and arguments over disinformation.