This is Senator Ron Johnson's letter to Defense Secretary Austin about the original data. https://www.ronjohnson.senate.gov/2022/2/sen-johnson-to-secretary-austin-has-dod-seen-an-increase-in-medical-diagnoses-among-military-personnel
Soon after this data was made public the Dept of Defense deleted all the original data from the years prior to 2021 and replaced it with new data with much higher numbers that hid the 2021 spikes.
This is a massive cover up of diseases and injuries in the US Military that began in 2021. Read more about that coverup here:
The following is an English Translation of Professor Ehud Qimron's open letter to the Israeli Ministry of Health.
Ministry of Health, it's time to admit failure. The truth is about to be revealed, and here it is beginning to be revealed in the policy towards the Corona as well.
Two years late, you finally realize that a respiratory virus cannot be defeated and that any such attempt is doomed to fail. You do not admit it, because you have admitted almost no mistake in the last two years, but in retrospect it is clear that you have failed miserably in almost all of your actions, and even the media is already having a hard time covering your shame.
You refused to admit that the infection comes in waves that fade by themselves, despite years of observations and scientific knowledge. You insisted on attributing every drop of a wave solely to your actions, and so through false propaganda "you overcame the plague." And again you defeated her, and again and again and again.
You refused to admit that mass testing is ineffective, despite * your * contingency plans explicitly stating so ("Pandemic Influenza Health System Preparedness Plan, 2007", p. 26).
You refused to admit that recovery is more protective than a vaccine, despite previous knowledge and observations showing that non-recovering vaccines are more likely to be infected than recovering. You refused to admit that vaccinated are contagious and contagious despite the observations. Based on this, you hoped to achieve herd immunity by vaccination - and you failed in that as well.
You insisted on ignoring the fact that the disease is dozens of times more dangerous for risk groups and adults, than for young people who are not in risk groups, despite the knowledge that came from China as early as 2020.
You refused to adopt the "Barrington Declaration" signed by more than 60,000 scientists and medical professionals, and common sense programs / DIP. You chose to ridicule, slander, distort and discredit them. Physicists as chief advisers to the government, veterinarians, security officers, media people and so on).
You have not set up an effective system for reporting side effects from the vaccines and even surfers' reports on side effects have been deleted from your Facebook page. Doctors avoid linking side effects to the vaccine, lest you persecute them as you did to some of their colleagues. You have ignored many reports of changes in menstrual power and menstrual cycle times. You hid data that allows for objective and proper research (for example, you removed the data on Ben Gurion Airport subjects). Instead, you chose to publish non-objective articles together with senior Pfizer stakeholders on the effectiveness and safety of vaccines.
Irreversible damage to trust
However, from the heights of your hubris, you have also ignored the fact that the end of the truth is revealed. And she begins to be revealed. The truth is that you have brought the public's trust in you to an unprecedented low, and you have eroded your status as a source of authority. The truth is that you have burned hundreds of billions of shekels in vain - for publishing intimidation, for ineffective tests, for destructive closures and for disrupting the routine of life in the last two years.
You have destroyed the education of our children and their future. You made children feel guilty, scared, smoke, drink, get addicted, drop out, and quarrel, as school principals around the country attest. You have harmed livelihoods, the economy, human rights, mental health and physical health.
You slandered colleagues who did not surrender in spite of you, who would incite each other's populations, divided society and polarized the discourse. They branded, without any scientific basis, people who chose not to get vaccinated as enemies of the public and as spreaders of disease. Their leadership, in an unprecedented way, leads a draconian policy of discrimination, denial of rights and selection of people, including children, for their medical choice. A selection that denies any epidemiological significance.
When you compare the destructive policies you are pursuing with the sane policies of other countries - you can clearly see that the destruction you have caused has only added victims beyond the vulnerability to the virus. The economy you destroyed, the unemployed you caused, and the children whose education you destroyed - are the surplus victims as a result of your own actions only.
There is currently no medical emergency, but you have been cultivating such a condition for two years now because of lust for power, budgets and control. The only emergency now is that you still set policies and hold huge budgets for propaganda and consciousness engineering instead of directing them to strengthen the health care system.
This emergency must stop!
Prof. Udi Qimron, Faculty of Medicine, Tel Aviv University 06.01.22
Original Hebrew: https://mobile.mako.co.il/news-columns/2022_q1/Article-dfd99ca599e2e71026.htm
About a year before the Covid19 pandemic, researchers identified a cause for the severe disease in the original SARS-1 virus. An immune system dysfunction caused by antibodies to the SARS-1 Spike Protein (S-IgG) heightened the inflammatory immune responses and suppressed the healing response. This caused severe acute lung injury. All those who cleared the virus before S-IgG antibodies developed had no severe disease.
There are reasons to believe this has been happening in SARS-2. Dr. Chankra Chetty treated over 4000 Covid19 patients in S.Africa he described day 8 as the onset of the inflammatory phase in Covid19 when it all gets much worse and shortness of breath begins. Day 8 also happens to be the first day IgG antibodies become detectable. He said up to day 7 there are none of those severe symptoms.
As we know, the vaccines solicit production of S-IgG antibodies to the spike protein. If S-IgG does the same thing in SARS-2 as it did in SARS-1, we would expect to see a massive increase in symptomatic disease in the most recently vaccinated people as they would have the highest levels of circulating S-IgG antibodies. Is this why Israels case rates are skyrocketing right now? They just went all out for the 4th vaccine shot.
I have tried to put this information out there on reddit but they censor me.
Day Star TV is presenting a non-stop exposé of the satan that is big pharma's covid vaccine companies and their evil propogators like Fauci and Biden. Daystar and their guests like Dr Ryan Cole are covering everything from safe alternatives like Ivermectin to the deadly effects of Fauci's protocols like Remdisivir and Intubation. They are discussing the origins of the virus with experts that explain the gain of function research that created it and Rand Paul's investigation.
You can watch Daystar on regular TV if you have an antenna or on
None of the people of Afghanistan did anything to any of us in the United States yet the same Bush Administration Jews that contrived the WMD's lie to Invade Iraq, conspired to contrive the 9/11 lies that they used as a pretext to send the US military to attack Afghanistan and spend 20 years killing and maiming hundreds of thousands of their people. Now 20 years on we get to watch our slimebag news media describe the Taliban as the terrorists when their only crime was fighting to defend their country against the invaders.
What a bunch of fucking horseshit.
The first is the one analysed by the scientists from India in January 2020. It's spike protein is almost identical to the spike on the original SARS-CoV-1 virus except for four new spliced in gene fragments that matched sequences from HIV-1. Those scientists published the genome of that spike protein in their paper, you can view that genome sequence here. https://www.biorxiv.org/content/biorxiv/early/2020/01/31/2020.01.30.927871/F2.large.jpg
You can see they aligned the new SARS-CoV-2 sequence above the original SARS to highlight where they are different.
I reference the four inserts here by their position in that genome.
076: GTNGTKR
148: YYHKNNKS
256: GDSSSG
681: QTNSPRRA
Now look here at this SARS-CoV-2 Spike genome on the NCBI website. https://www.ncbi.nlm.nih.gov/protein/6VXX_C (scroll to the bottom of the page to see it).
You might notice the same 4 inserts are also present here but they are 15 places further up because the beginning part of this genome is different from the first one.
091: GTNGTKR
163: YYHKNNKS
271: GDSSSG
696: QTNSPSGA
Now look at the end part of that genome at position 1246 (near the end of the second to last row after GGGGS).
You will see this part of the genome is also different to the first one, the sequence beginning at position 1246 and ending at 1273 is,
GYIPE APRDGQAYVR KDGEWVLLST FLG
Now look at the genome for the gp41 protein in HIV-1.
You see gp41 is a relatively short sequence of 58 nucleotides.
GYIPEAPRDG QAYVRKDGEW VLLSTFLGSS GNEQELLELD KWASLWNWFN ITNWLWYIK
Now I put the sequence we just examined from the SARS-CoV-2 Spike genome directly above the HIV-1 gp41 sequence to compare them.
GYIPEAPRDGQAYVRKDGEWVLLSTFLG
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSS GNEQELLELD KWASLWNWFN ITNWLWYIK
You can see the matching sequence of the 28 nucleotides. This sequence was not present in the first genome from the Indian research paper.
What this means is, there was not just a leak of one virus from a lab. These are two distinct and separate versions of the same lab engineered virus. The first had 4 new inserts that matched sequences from HIV-1. The second has 5.
This means everything we have been told up to this point about the pandemic has been a pack of lies. These two distinctly different versions of the same virus could not have been accidental leak. This was obviously something deliberate.