The first is the one analysed by the scientists from India in January 2020. It's spike protein is almost identical to the spike on the original SARS-CoV-1 virus except for four new spliced in gene fragments that matched sequences from HIV-1. Those scientists published the genome of that spike protein in their paper, you can view that genome sequence here. https://www.biorxiv.org/content/biorxiv/early/2020/01/31/2020.01.30.927871/F2.large.jpg
You can see they aligned the new SARS-CoV-2 sequence above the original SARS to highlight where they are different.
I reference the four inserts here by their position in that genome.
076: GTNGTKR
148: YYHKNNKS
256: GDSSSG
681: QTNSPRRA
Now look here at this SARS-CoV-2 Spike genome on the NCBI website. https://www.ncbi.nlm.nih.gov/protein/6VXX_C (scroll to the bottom of the page to see it).
You might notice the same 4 inserts are also present here but they are 15 places further up because the beginning part of this genome is different from the first one.
091: GTNGTKR
163: YYHKNNKS
271: GDSSSG
696: QTNSPSGA
Now look at the end part of that genome at position 1246 (near the end of the second to last row after GGGGS).
You will see this part of the genome is also different to the first one, the sequence beginning at position 1246 and ending at 1273 is,
GYIPE APRDGQAYVR KDGEWVLLST FLG
Now look at the genome for the gp41 protein in HIV-1.
You see gp41 is a relatively short sequence of 58 nucleotides.
GYIPEAPRDG QAYVRKDGEW VLLSTFLGSS GNEQELLELD KWASLWNWFN ITNWLWYIK
Now I put the sequence we just examined from the SARS-CoV-2 Spike genome directly above the HIV-1 gp41 sequence to compare them.
GYIPEAPRDGQAYVRKDGEWVLLSTFLG
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSS GNEQELLELD KWASLWNWFN ITNWLWYIK
You can see the matching sequence of the 28 nucleotides. This sequence was not present in the first genome from the Indian research paper.
What this means is, there was not just a leak of one virus from a lab. These are two distinct and separate versions of the same lab engineered virus. The first had 4 new inserts that matched sequences from HIV-1. The second has 5.
This means everything we have been told up to this point about the pandemic has been a pack of lies. These two distinctly different versions of the same virus could not have been accidental leak. This was obviously something deliberate.
If this is true, then it could be possible that the variant 1 (Wuhan Virus) was used to scare monger because it was an actual deadly virus and the vaccines were used to protect you from that while the second (Flu) is used to scare monger and justify government tyranny for 21 - 24 months. Which means they could also spread the actual Wuhan Virus (Strain 1) to kill the unvaccinated.
And yes I'm not the only person speculating this.
No. These are not flu. The five inserts include 3 from the HIV gp120 protein and that one from gp41. Both of those proteins are used by HIV to break into the immune system CD4+ T cells. They are part of the HIV warhead that infects and takes out the human immune system. What do you get when you splice HIV weaponary into a coronavirus? Coronavirus is airborne.
Yup.
Only difference I think is that they will use the Wuhan Virus to kill the vaccinated through ADE.
We'll start to find out in October.
Nah, they will go for the resilient people first, so it makes sense for them to kill the unvaccinated with it. I do not know if the Elites are injected with Saline, but if they did in such a scenario they would be effectively self terminating.
It will simply be self defeating one way or another, but the goal is defintely not population wiping vaccines or just vaccines in general.
No, people will visibly die or get hospitalized by droves by now if this were the plan, unless you say the Elite can kill us in a wonderful click of a button by October.
Chances are they will just infinitely perpetuate the masks, free movement bans and lockdowns for "no apparent reason" until people start dying in droves via suicides or breakdowns. If it comes to a point where a suicide pandemic strikes Australia or Japan that wipes out 40% of their population in 1 decade, they had pretty much achieved a goal.
It might not be that fast - HIV didn't kill people immediately, took months or years before the purple spots appeared